Other specifications inquiry
Item No.
Product Name
Specification
Amount
End User or Agent
Unit Name
Company Website
Contacts
Mobile
Email
Country/Region

Recombinant Human CD59

rHuCD59

Item No:701-04
Price:
$ 84
Specification:
Amount:
- +
Technical Data
    Source
    Escherichia coli.
    Molecular Weight
    Approximately 9.0 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
    AA Sequence
    LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
    Purity
    > 97 % by SDS-PAGE analyses.
    Biological Activity
    Testing in progress.
    Physical Appearance
    Sterile Filtered White lyophilized (freeze-dried) powder.
    Formulation
    Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0, with 1 mM DTT, 5 % trehalose.
    Endotoxin
    Less than 0.1 EU/μg of rHuCD59 as determined by LAL method.
    Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
    Shipping
    The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below.
    Stability & Storage
    Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
    - 12 months from date of receipt, -20 to -70 °C as supplied.
    - 1 month, 2 to 8 °C under sterile conditions after reconstitution.
    - 3 months, -20 to -70 °C under sterile conditions after reconstitution.
    Usage
    This material is offered by Shanghai PrimeGene Bio-Tech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
    Background
    CD59, also known as membrane attack complex inhibition factor (MACIF) and Protectin, is an approximately 8.92kDa GPI‑anchored glycoprotein that is an important regulator of the complement system in blood. The complement system triggers innate immune responses to immune complexes, MBL‑opsonized microorganisms, and apoptotic cells through the classical, lectin, and alternative pathways. One major consequence of complement activation is the assembly of a membrane attack complex (MAC) composed of one molecule each of complement proteins C5b, C6, C7, and C8(C5b‑8) followed by the incorporation of multiple copies of C9(C5b‑9). Membrane insertion of the MAC results in formation of a cytolytic pore in the target cell.CD59, which is widely expressed on healthy cells, binds to both C8 and C9 and shields them from complement‑mediated lysis. It inhibits MAC pore formation by blocking C5b‑8 complex membrane insertion and the incorporation of C9 molecules. The binding of CD59 to C8 and C9 is species‑selective, and this contributes to the restricted ability of MACs to lyse cells of other species. The cytoprotective function of CD59 plays a variety of roles in pathology. It limits tissue damage and inflammation following ischemia/reperfusion injury. It also protects against the development of atherosclerosis and abdominal aortic aneurysms. Its protectiveness can be inactivated by diabetes‑induced glycation, leading to increased MAC deposition and hemolytic anemia. In contrast, CD59 can be exploited to promote red cell lysis; it functions as a cellular receptor for the bacterial pore‑forming toxin intermedilysin. CD59 can be incorporated into several enveloped viruses such as hepatitis C virus where it limits the destruction of virus particles. Aside from its complement regulatory functions, CD59 limits the activation of T cells following their interaction with antigen presenting cells, but it promotes NK cell activation through association with NKp30 and NKp46. In mouse, gene duplication has given rise to two related proteins, CD59a and CD59b. Mature human CD59 shares 37%, 43%, and 44% amino acid sequence identity with mouse CD59a, mouse CD59b, and rat CD59, respectively.
    1Why do proteins need to be lyophilized? What are the effects on proteins?
    + -
    Proteins are heat sensitive and lyophilization allows the protein to be stored with maximum activity, extended shelf life, and reduced transportation costs. The effects of lyophilization on proteins include the possibility of partial inactivation, aggregation and other denaturation problems. However, these negative effects can be minimized by adding protective agents (stabilizers, additives, excipients) and controlling the various conditions of lyophilization.
    2Why add protectants to the protein solution before lyophilization? What are the common protective agents used by PrimeGene?
    + -
    Freeze-drying has a certain effect on the activity of proteins, and the addition of a protective agent can reduce this effect and maximize the protection of protein activity. The usual protectants or stabilizers are sugars, polyols, polymers, surfactants, certain proteins and amino acids. Our common protective agents are: trehalose, mannitol, etc.
    3Why do some proteins come with labels?
    + -
    The tagged proteins are generally used to meet the experimental requirements of some customers. If His-tag and GST-tag are required, affinity purification columns can be used; proteins fused to Fc fragments of immunoglobulins can be used for antibody studies, etc.
    4How is the protein quantified?
    + -
    Usually three methods, BCA ,Bradford and OD280, are used for quantification.
    5Why the results measured by my quantification method do not match the quantification on the PrimeGene label?
    + -
    Different protein quantification methods are used and will give different results. Sometimes the difference in results caused by different quantification methods is significant.
    6I purchased a small package of lyophilized protein, why did I receive only one empty tube?
    + -
    Unlike some protein products on the market, the vast majority of our products do not contain carrier proteins or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and alginose) and are lyophilized in a solution with minimal salt content. As a result, trace amounts of protein are deposited inside the tube during the lyophilization process, forming a very thin or almost invisible protein layer, and even the protein powder can drift on the tube walls. Before opening the cap, we recommend rapid centrifugation in a centrifuge for 20-30 seconds to allow the protein powder attached to the cap or wall to collect at the bottom of the tube.
    7How to reconstitute the lyophilized powder protein?
    + -
    Unless the instructions are more specific, we recommend the following.
    (1) Equilibrate the reagent bottle and reconstitute buffer to room temperature.
    (2) Centrifuge the reagent vial briefly to ensure that all lyophilized material is collected at the bottom of the vial.
    (3) Add the recommended re-dissolution buffer to the concentration recommended on the product description. Avoid vigorous shaking or pipette blowing, which may result in denaturation of the protein.
    (4) Allow reagent vials to redissolve at room temperature for 15-30 minutes, either using a 360 degree shaker or manually by gently inverting up and down.
    (5) Dispense in volumes no less than 10μl per tube and store as directed on the product insert.
    (6) If the vial presents flakes or pellets, mix the product at room temperature for several hours and then overnight at 4°C.
    8How to determine the reference dosage for protein activity experiments?
    + -
    All protein products which have been verified by biological activity have activity verification information on our product page, customers can check the information of cell type used and ED50 value in the Biological Activity column.
    9Why is ED50 a range?
    + -
    A bioactivity assay is a measurement of the biological response of a protein. Therefore, any changes in the bioactivity assay may also lead to different results. Such variations may include cell density, cell age, number of passages, nutritional status, media and additives used, as well as the experimental operator's practices. Due to the variable nature of bioactivity assays, the same protein may not produce the same ED50 under different circumstances. For this reason, PrimeGene's protein instructions give a range of ED50s.
    10Application of products
    + -
    Our products can be classified according to scientific fields, but no clear guidance is given on their specific applications. Since proteins can be explored for multiple applications and methods of application according to their functions, we recommend our customers to conduct experiments according to the literature or to explore their own application methods based on scientific research.
    11Can the protein be used for in vivo experiments (In vivo)? What is the recommended concentration?
    + -
    PrimeGene Protein does not perform any in vivo testing. We do not have data on the activity and half-life of these products in in vivo applications.
    12What is Trehalose and what is its role in the formulation?
    + -
    Trehalose is a non-reducing sugar that does not react with amino acids or proteins in the Murad reaction. It is found in many plants and animals in nature. Alginate stabilizes proteins against damage caused by freezing and also makes them more resistant to water when freeze-dried, thus making it less likely that the product will precipitate upon re-solution.
    13If the product contains trehalose, will in vivo experiments (In vivo) affect the animals?
    + -
    Trehalose is unlikely to affect in vivo experiments. It is approved for use as an excipient in human injectable drugs. The trehalose used in the R&D system is derived from brewer's yeast and has a purity of at least 98.5% as determined by HPAE.
    14Does trehalose interfere with the ligation reaction (Conjugation)?
    + -
    The presence of trehalose may interfere with the successful binding of proteins. This will depend on the method of conjugation and customers are advised to do the relevant research before purchasing the product.
    15The lyophilized form of the recombinant protein product arrives at room temperature and the instructions indicate that it should be stored at -20ºC. Does this shipping method affect the activity of the product?
    + -
    The lyophilized powder product is shipped at ambient temperature (Ambient) and will not be affected. Freeze-drying improves the stability of the protein product while reducing packaging materials and shipping costs. We have tested the shipping conditions of our freeze-dried products to ensure product quality.
    16How to store the product?
    + -
    Because of the different nature of the products, please read the instructions carefully and store them properly according to the methods described in the instructions.
Do you want to learn more about our product?
Try our product selector
Screening Products
Similar Product Recommendations
Contact Us
Service Hotline:400-821-3475
Address: 8F, Building A5, Bay Valley Technology Park, Lane 1688, North Guoquan Road, Shanghai
Zip Code:200438
Phone:021-61072066
Order E-mail:order.PG@bio-techne.com
Inquiry E-mail:info.PG@bio-techne.com
COA Application
Thank you for your support and trust in PrimeGene, please enter the Lot No. and Catalog No. for inquiry.
Specification:
Contact Us

Service Hotline:400-821-3475

Inquiry E-mail:order.PG@bio-techne.com

Inquiry E-mail:info.PG@bio-techne.com

Dealer inquiry
BeiJing
ShangHai
ChongQing
JiangSu
ZheJiang
GuangDong
AnHui
TianJin
HeBei
ShanXi
NeiMengGu
LiaoNing
JiLin
HeiLongJiang
FuJian
JiangXi
ShanDong
HeNan
HuBei
HuNan
GuangXi
HaiNan
SiChuan
GuiZhou
YunNan
XiZang
ShanXi
GanSu
QingHai
NingXia
XinJiang
XiangGang
AoMen
TaiWan
Search Results

Delivery

Price Inquiry

Technical Consulting